Description | Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MDAALQEQFSRVQSALETLVDSIAAYNPSTQAAGELLAADNALSRGLDQLAQHQANHRRIQSLRARADALEEQLRTSVATLAGLRRELFDTPATTFPSDSRPVPASELLLYAKNISQHTVPPTYREPVLAVPVEESKGGTPSAQATPANAALAAANDGQPSNGETTLEPATDVTVEEAEWLKKLQESNTAWVPWPSDEKIRGSNLMQIQYLIDTGQDPKLVDLTKLGEDEKENIAADAQRAADQLQHANVEPHRAHPSAHPPAAPRAPAETFGGFDFLDDDDD |
Length | 283 |
Position | Middle |
Organism | Periconia macrospinosa |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Pleosporomycetidae> Pleosporales> Massarineae> Periconiaceae> Periconia. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.564 |
Instability index | 50.46 |
Isoelectric point | 4.61 |
Molecular weight | 30564.25 |
Publications | PubMed=29679020 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP20785 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 126.96| 39| 41| 97| 137| 1 --------------------------------------------------------------------------- 97- 137 (60.73/39.69) PSdSRPVPASELlLYAKNISQHTVPPTYREPVLAVPVEESK 141- 179 (66.23/35.38) PS.AQATPANAA.LAAANDGQPSNGETTLEPATDVTVEEAE --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) AAPRAPAETFGGFDFLDDDDD 2) LLYAK 3) LMQIQYLI | 263 109 205 | 283 113 212 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab