<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20784
Description |
Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MPPAIPPLDEQVFERPDILSGLPGGNINADSILWYFMNSPFYDPASNNSALFNQLRNDPNGMAIMQDRRALEERLRTGFPTGISYVVASEPSTPEEPWVIQRQFIAVKGGPVQVQGTYYTAGMKILMAPSLLDILRSRMLSVSTHMAEVFETSKELSHFAPATNHSYLPATYDTTGKAATASRIGSRIGSPTLAATDPDAAPSQSQSQPPSQQPSGTAFSDALFMSSMHLTSSYYHEFMDENPLTGEPGAFVYNKTYDAVLAEQAQARQKQEQKQQKHQQQIADAVAAANSATGKMEPRSTTNSAAATPRTGPVGTPVPAGVAEVHSRKGSASGASKPAKEKRRKSKGLGSPVTPTAGQAGL |
Length | 362 |
Position | Head |
Organism | Periconia macrospinosa |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Pleosporomycetidae> Pleosporales> Massarineae> Periconiaceae> Periconia.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.479 |
Instability index | 62.17 |
Isoelectric point | 7.08 |
Molecular weight | 38740.94 |
Publications | PubMed=29679020
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP20784
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 223.60| 76| 115| 42| 123| 1
---------------------------------------------------------------------------
25- 109 (113.91/64.00) GNINADSIlwYFMNSP..................................fYDPASNNSALfnQLRNDPNGMAIMQDRRAleerLRTGFPTGISYVVASEPS.TPEEPWVIQRQFIAVKG
110- 221 (109.69/50.72) GPVQVQGT..YYTAGMkilmapslldilrsrmlsvsthmaevfetskelshFAPATNHSYL..PATYDTTGKAATASRIG....SRIGSPTLAATDPDAAPSqSQSQPPSQQPSGTAFSD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 73.87| 16| 16| 305| 320| 2
---------------------------------------------------------------------------
287- 302 (24.74/ 9.86) AAANSATGKM.EPRSTT
305- 320 (28.35/12.14) AAATPRTGPV.GTPVPA
323- 339 (20.78/ 7.36) AEVHSRKGSAsGASKPA
---------------------------------------------------------------------------
|