<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20779
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MAQPPPEEEEQFLTSIFPAPPPFYKHFTPTNLSALKDAQEKLSPNTNDQNSNKNSKDASSSSFPTTTLTPTQLLDLPAPLREQLTYLIPPPPPDPSVEYRVFGKPTKLGGDDPFEYIMQYVRNRLWNPDTSQGLLPLWEYERLYPADPSSKSSLSREGAGDTQMTDENNNNNTQTTQQQGEGGGGGDWGTLDRQTYLFRFLRSIIIKHVELLGILATDPTAPAPPDADGNGPQVILPENPFNPGTPLYDKAKDKVLREILNLVMNMHALINEYRPHQARETLIRVLEGQVERKKKEIEGVRRMAGRVGEALEGLRGAAAAAGGGEEGGGVDGNEGEGSSSGGGGGVEKDEEKIAMREMWRALEGV |
| Length | 365 |
| Position | Middle |
| Organism | Periconia macrospinosa |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Pleosporomycetidae> Pleosporales> Massarineae> Periconiaceae> Periconia.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.732 |
| Instability index | 46.60 |
| Isoelectric point | 4.85 |
| Molecular weight | 39949.04 |
| Publications | PubMed=29679020
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP20779
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 69.02| 16| 16| 316| 331| 2
---------------------------------------------------------------------------
299- 315 (21.53/ 8.51) GV...RRMAGrVGEALEGLR
316- 331 (28.88/13.55) GA...AAAAG.GGEEGGGVD
332- 347 (18.61/ 6.51) GNegeGSSSG.G...GGGVE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 66.66| 17| 70| 4| 22| 3
---------------------------------------------------------------------------
4- 22 (30.80/17.99) PPPEEEEqfLTSIFPAPPP
77- 93 (35.86/15.66) PAPLREQ..LTYLIPPPPP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.84| 13| 16| 123| 135| 4
---------------------------------------------------------------------------
123- 135 (24.94/14.30) NRLWNPD.TSQGLL
141- 154 (17.90/ 8.48) ERLYPADpSSKSSL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 58.27| 15| 19| 214| 228| 5
---------------------------------------------------------------------------
214- 228 (28.02/13.46) ILATDPTAPAPPDAD
235- 249 (30.26/15.11) ILPENPFNPGTPLYD
---------------------------------------------------------------------------
|