Description | Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MAQPPPEEEEQFLTSIFPAPPPFYKHFTPTNLSALKDAQEKLSPNTNDQNSNKNSKDASSSSFPTTTLTPTQLLDLPAPLREQLTYLIPPPPPDPSVEYRVFGKPTKLGGDDPFEYIMQYVRNRLWNPDTSQGLLPLWEYERLYPADPSSKSSLSREGAGDTQMTDENNNNNTQTTQQQGEGGGGGDWGTLDRQTYLFRFLRSIIIKHVELLGILATDPTAPAPPDADGNGPQVILPENPFNPGTPLYDKAKDKVLREILNLVMNMHALINEYRPHQARETLIRVLEGQVERKKKEIEGVRRMAGRVGEALEGLRGAAAAAGGGEEGGGVDGNEGEGSSSGGGGGVEKDEEKIAMREMWRALEGV |
Length | 365 |
Position | Middle |
Organism | Periconia macrospinosa |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Pleosporomycetidae> Pleosporales> Massarineae> Periconiaceae> Periconia. |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.732 |
Instability index | 46.60 |
Isoelectric point | 4.85 |
Molecular weight | 39949.04 |
Publications | PubMed=29679020 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364060 ECO:0000256 ARBA:ARBA00003669 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP20779 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 69.02| 16| 16| 316| 331| 2 --------------------------------------------------------------------------- 299- 315 (21.53/ 8.51) GV...RRMAGrVGEALEGLR 316- 331 (28.88/13.55) GA...AAAAG.GGEEGGGVD 332- 347 (18.61/ 6.51) GNegeGSSSG.G...GGGVE --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 66.66| 17| 70| 4| 22| 3 --------------------------------------------------------------------------- 4- 22 (30.80/17.99) PPPEEEEqfLTSIFPAPPP 77- 93 (35.86/15.66) PAPLREQ..LTYLIPPPPP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 42.84| 13| 16| 123| 135| 4 --------------------------------------------------------------------------- 123- 135 (24.94/14.30) NRLWNPD.TSQGLL 141- 154 (17.90/ 8.48) ERLYPADpSSKSSL --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 58.27| 15| 19| 214| 228| 5 --------------------------------------------------------------------------- 214- 228 (28.02/13.46) ILATDPTAPAPPDAD 235- 249 (30.26/15.11) ILPENPFNPGTPLYD --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) EQFLTSIF 2) PFYKHFT 3) PLWEYERLY | 10 22 136 | 17 28 144 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab