| Description | CSE2-domain-containing protein |
| Sequence | MADILTQIQDELDMLLNQMQSSLAYIHYRTPPAPIQNQPLLSSFAEHEAQTQAQQAASQPNNAQPAPAAPEPLPTPEEFQKDIRELSRDLLLKEQQIEVLIGSLPGLHSSEAEQVERMRELEKELEELEGERLKAVKEKEELVKLVEGRIMSLGESA |
| Length | 157 |
| Position | Middle |
| Organism | Periconia macrospinosa |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Pleosporomycetidae> Pleosporales> Massarineae> Periconiaceae> Periconia. |
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.590 |
| Instability index | 54.63 |
| Isoelectric point | 4.54 |
| Molecular weight | 17646.72 |
| Publications | PubMed=29679020 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 ARBA:ARBA00003669 ECO:0000256 RuleBase:RU366036 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule |
| GO - Biological Function | |
| GO - Biological Process |
| Binary Interactions |
| Repeats |
>MDP20778
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 34.23| 14| 15| 124| 138| 1
---------------------------------------------------------------------------
124- 138 (16.60/ 9.73) ELEEL.EGeRLKAVKE
141- 155 (17.63/ 6.39) ELVKLvEG.RIMSLGE
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) EFQKDIR 2) SLAYIHYRTPP | 78 22 | 84 32 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab