<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20778
| Description |
CSE2-domain-containing protein |
| Sequence | MADILTQIQDELDMLLNQMQSSLAYIHYRTPPAPIQNQPLLSSFAEHEAQTQAQQAASQPNNAQPAPAAPEPLPTPEEFQKDIRELSRDLLLKEQQIEVLIGSLPGLHSSEAEQVERMRELEKELEELEGERLKAVKEKEELVKLVEGRIMSLGESA |
| Length | 157 |
| Position | Middle |
| Organism | Periconia macrospinosa |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Pleosporomycetidae> Pleosporales> Massarineae> Periconiaceae> Periconia.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.590 |
| Instability index | 54.63 |
| Isoelectric point | 4.54 |
| Molecular weight | 17646.72 |
| Publications | PubMed=29679020
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP20778
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 34.23| 14| 15| 124| 138| 1
---------------------------------------------------------------------------
124- 138 (16.60/ 9.73) ELEEL.EGeRLKAVKE
141- 155 (17.63/ 6.39) ELVKLvEG.RIMSLGE
---------------------------------------------------------------------------
|