Description | CSE2-domain-containing protein |
Sequence | MADILTQIQDELDMLLNQMQSSLAYIHYRTPPAPIQNQPLLSSFAEHEAQTQAQQAASQPNNAQPAPAAPEPLPTPEEFQKDIRELSRDLLLKEQQIEVLIGSLPGLHSSEAEQVERMRELEKELEELEGERLKAVKEKEELVKLVEGRIMSLGESA |
Length | 157 |
Position | Middle |
Organism | Periconia macrospinosa |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Pleosporomycetidae> Pleosporales> Massarineae> Periconiaceae> Periconia. |
Aromaticity | 0.03 |
Grand average of hydropathy | -0.590 |
Instability index | 54.63 |
Isoelectric point | 4.54 |
Molecular weight | 17646.72 |
Publications | PubMed=29679020 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 ARBA:ARBA00003669 ECO:0000256 RuleBase:RU366036 |
GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule |
GO - Biological Function | |
GO - Biological Process |
Binary Interactions |
Repeats | >MDP20778 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 34.23| 14| 15| 124| 138| 1 --------------------------------------------------------------------------- 124- 138 (16.60/ 9.73) ELEEL.EGeRLKAVKE 141- 155 (17.63/ 6.39) ELVKLvEG.RIMSLGE --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) EFQKDIR 2) SLAYIHYRTPP | 78 22 | 84 32 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab