<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20771
Description |
Cyclin-C |
Sequence | MAANYWESTQRRHWQFTRQQLEDMRKKLEEEDQNLVKMYPLPEIRHQSIYFNQQIARLGKRLGVRQQAMVTAQLYIRRFYFKVEIRRTNPYLVIATAVYLACKMEECPHHIRLVVSEGRSLWPDFFSSDTSKLGECEFFLISEMSSQMIIHHPYRSLTSLQGIFSLTQEESALAWSIINDHYMTDLPLLFAPHIIAITSILLALVLRPNTTGVQSASGSASNMASAAQSALSSAGNEKQGGGPRSKVQKLANWLAESNINIENIVDCTQEIISFYEVQEQYNEKLTREQINRFVKARGLDK |
Length | 301 |
Position | Kinase |
Organism | Cadophora sp. DSE1049 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes>
Helotiales> Helotiales incertae sedis> Cadophora> unclassified Cadophora.
|
Aromaticity | 0.09 |
Grand average of hydropathy | -0.323 |
Instability index | 69.48 |
Isoelectric point | 8.28 |
Molecular weight | 34626.19 |
Publications | PubMed=29679020
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP20771
No repeats found
|