| Description | Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MTSQEIPLDEIQWKSPPLVQQMQGVHENSVLHYFASSPFFDQTSNNAVLTNQAMFNPNMLEVIQTRAAFEGRLKTMSGLEFVIAEQPAEMAPGTGTGVWVIRKQTRRKRDRDEDEITVHSTYFVVGDNIYMAPTVADVLANRTMSVISSINKFNTKAAALPEFSPALGHVYMQPPSGNRLKNGESQLSQGSKENTPLPESLQNPKKPNPSTPNSGADYLDNRLLEETINISLKYGDEYMDEIPITGAPGEFHLSSTGRKDKDKLMVPAITKGPTSAPSKPATPAPPPLKTDVPPERKNSKAEKSPKTPGMPKPKRRKSKGLGLGSGGMSPTT |
| Length | 332 |
| Position | Head |
| Organism | Cadophora sp. DSE1049 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes> Helotiales> Helotiales incertae sedis> Cadophora> unclassified Cadophora. |
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.654 |
| Instability index | 55.38 |
| Isoelectric point | 9.01 |
| Molecular weight | 36270.74 |
| Publications | PubMed=29679020 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP20765
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.01| 15| 38| 145| 162| 1
---------------------------------------------------------------------------
145- 162 (21.26/19.93) SVISSINKFNTkaaALPE
185- 199 (27.76/17.12) SQLSQGSKENT...PLPE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 34.59| 10| 87| 207| 217| 2
---------------------------------------------------------------------------
207- 217 (16.38/12.77) PnPSTPNSGAD
293- 302 (18.21/ 8.87) P.PERKNSKAE
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) KLMVPAITKG 2) KTDVPPERKNSKAEKSPKTPGMPKPKRRKSKGLGLGSG | 263 289 | 272 326 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab