<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20757
| Description |
Mediator of RNA polymerase II transcription subunit 8 |
| Sequence | MNKLQRQPPAQAQRPSPSPQVNTQIPAESLELIRNRLSQVHQSLRKLADQINLHNRNPAKVRLPSYSNLQSQFQVLITQLQTIAARLDSNDETLKTTNVYPLPAFPTTQHEGLVTTLLRKKPLPEVDEWIDAAIAESDQFKLPIHADDDFAEWCYAKVKELEDEFTFEGFHTEAELEFMETDEGQKAEEARKEADKEKEKLNSEVSGGKTPMSPNVVLRFINRGVIQ |
| Length | 227 |
| Position | Head |
| Organism | [Candida] haemulonis |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Metschnikowiaceae> Clavispora> Clavispora/Candida clade.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.711 |
| Instability index | 44.61 |
| Isoelectric point | 5.26 |
| Molecular weight | 25856.77 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP20757
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 75.21| 23| 23| 127| 149| 1
---------------------------------------------------------------------------
127- 149 (41.22/28.20) DEWIDAAIAE.SDQFKL.PIHADDD
151- 175 (33.99/22.18) AEWCYAKVKElEDEFTFeGFHTEAE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.52| 14| 18| 90| 103| 2
---------------------------------------------------------------------------
90- 103 (26.30/18.08) NDETLKTTNVY..PLP
109- 124 (21.22/13.36) QHEGLVTTLLRkkPLP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 113.86| 34| 47| 4| 37| 3
---------------------------------------------------------------------------
4- 37 (60.08/34.96) LQRQPPAQAQRPSPSP.QVNTQIPAESLELIRNRL
53- 87 (53.78/30.66) LHNRNPAKVRLPSYSNlQSQFQVLITQLQTIAARL
---------------------------------------------------------------------------
|