<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20754
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MLPHKNNQSTNSVPISRVGSSAKLNHLNVPGSNSRPTSRPNTPSSYVTSSLNPTRNIPVTSNSINSKIKNQEEAALFEALPITSSIRDFENELVELSSSISSFKEENIPSHVERLIQIDKTLSSEQQNLRKHQELGVEIETLSKENEDLSKESSRFLKELIACRAELKKLPRLPAAQTSSRSSRLKEIGVQELLDYSMTLAKFSKAPTTASGQMPHPNNFIWPAEDALRRGLLALTSLKSDEVIRAELGEPEAEAKEEKEKEEDDDIEMEDVQDMSAPTTKVHREEHAPRKIEVNKAPQALNLDLFDGDDSDDSD |
| Length | 315 |
| Position | Middle |
| Organism | [Candida] haemulonis |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Metschnikowiaceae> Clavispora> Clavispora/Candida clade.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.771 |
| Instability index | 58.89 |
| Isoelectric point | 5.07 |
| Molecular weight | 35078.59 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP20754
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.82| 19| 20| 106| 125| 1
---------------------------------------------------------------------------
106- 125 (26.55/21.51) ENIPSHVERLIQIDkTLSSE
127- 145 (30.27/19.45) QNLRKHQELGVEIE.TLSKE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 70.17| 20| 21| 2| 21| 2
---------------------------------------------------------------------------
2- 21 (37.02/21.42) LPHKNNQSTNSVPISR..VGSS
24- 45 (33.15/18.51) LNHLNVPGSNSRPTSRpnTPSS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 93.59| 28| 70| 206| 233| 3
---------------------------------------------------------------------------
206- 233 (52.87/32.09) APTTASGQMPH.PNNF.IWPAEDALRRGLL
277- 306 (40.72/23.27) APTTKVHREEHaPRKIeVNKAPQALNLDLF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 62.55| 17| 20| 57| 73| 5
---------------------------------------------------------------------------
57- 73 (28.14/18.99) IPVTSNSINSKIKNQEE
80- 91 (20.00/11.31) LPITSS.....IRDFEN
92- 105 (14.41/ 6.04) ELVELSSSISSFKE...
---------------------------------------------------------------------------
|