<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20752
| Description |
Uncharacterized protein |
| Sequence | MSADYWSSSQRTKWQLTREGLMESRRKLVLLEKKMVQGGLIKENPQVVYDVNMRIYLHTLVVKLGRRLNVRQIALASAEVYLFRFLTRVSLKEVNAYLLVTTCLYVACKIEECPQHLRLIVSEARNLWPEYIPHDVTKLAEFEFYLIEEMESYLLLHHPYKSLLQIRDFLRENSGHFGFSLTDDELQHSWSLINDSYITDLHLLFPPHVIAMAAIYITVVLKKNLNAIRSAGGPVGSQSNDEKSSAMHLDDLMTLNAGGEVDIQSTSGGNLPDSRLDEDTVKIDRFMNFFNYSHVNLDEMVEAMQEMINLYISWDRYNENQVRKALQQMLLSR |
| Length | 333 |
| Position | Kinase |
| Organism | [Candida] haemulonis |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Metschnikowiaceae> Clavispora> Clavispora/Candida clade.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.198 |
| Instability index | 43.09 |
| Isoelectric point | 5.90 |
| Molecular weight | 38626.97 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP20752
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 81.85| 20| 20| 288| 307| 1
---------------------------------------------------------------------------
270- 286 (19.12/ 9.53) ....NLPDSRLDEDTVKIDRF
288- 307 (34.55/22.38) NFF.NYSHVNLDEMVEAMQEM
309- 329 (28.17/17.06) NLYiSWDRYNENQVRKALQQM
---------------------------------------------------------------------------
|