<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20751
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MSEDLISSLYPSPPPYYKFFSDGNAKRFESWKSSNDDDGDVPPGDLKFHQPPPIPTGEQYRGYGSVWALANKLPSLQDSGWRQLYNDEDEKITSRTKILELHKLLDSLLLNFLELVGSVSKEPAKFYGKIEDLKLILINMNHLLNTYRPHQTRESLIMLLKRQIEGKRNDIRSIDETVLNVKNRIKEMAASTTTDSIILSHDIIGASKDRYIDRDEILETLRSLLNEQ |
| Length | 228 |
| Position | Middle |
| Organism | [Candida] haemulonis |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Metschnikowiaceae> Clavispora> Clavispora/Candida clade.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.600 |
| Instability index | 51.33 |
| Isoelectric point | 5.61 |
| Molecular weight | 26207.39 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP20751
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 75.25| 22| 37| 10| 35| 1
---------------------------------------------------------------------------
10- 35 (38.60/31.48) YPSPPPyykfFSDGNAKR.FES.WKSSN
48- 71 (36.65/19.85) FHQPPP....IPTGEQYRgYGSvWALAN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.08| 16| 37| 160| 176| 3
---------------------------------------------------------------------------
160- 176 (23.96/16.39) LKRQIEGKRNDiRSI..DE
199- 216 (24.12/12.17) LSHDIIGASKD.RYIdrDE
---------------------------------------------------------------------------
|