<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20742
| Description |
Mediator of RNA polymerase II transcription subunit 18 |
| Sequence | MVHQLLLCSSISQSNYIQTVSTLQALTGVLHPQDIATYTLLTKPHNVFKPKFEPGKVNQIEQYYMKCSTTWNDEAASELNLSQPIIAGKSDIRVERLFSGKKVKHWTLQISDIPNAGKNPVSAHNFYESTLVHHHTGKNVLISSTSPKVETSEEAKVEAKVEAKDEAKEEKKDDTKEAEKEEAKDDDIMQIDGPAKEDSTEKDKGDEDLMEIEPEGLPKTNGEGAEVTEITDIPDFADIPDSKETNEGDAIKKEEEKEPKTQVGETNSEVKDSFLQFLEELGYDVVNQYWQKGIRFFHGDIVIEIFKILVRDDDPSGAAEDSKLKLKLLDESNTFQIKAFINYQKGASVDLVNQGTKDLVKIKELLHNLFELEVPDRMYMDARVNRNQ |
| Length | 388 |
| Position | Head |
| Organism | [Candida] haemulonis |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Metschnikowiaceae> Clavispora> Clavispora/Candida clade.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.709 |
| Instability index | 29.87 |
| Isoelectric point | 4.82 |
| Molecular weight | 43786.45 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP20742
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.24| 19| 19| 176| 194| 1
---------------------------------------------------------------------------
176- 194 (32.09/18.39) KEAEKEEAK.DDDIMQI..DGP
196- 217 (20.15/ 8.85) KEDSTEKDKgDEDLMEIepEGL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 132.92| 43| 118| 109| 152| 3
---------------------------------------------------------------------------
109- 152 (68.90/47.58) QISDIPNAGKNPVSAHNfYESTLVHHHTGK..NVLISSTSPKVETS
229- 273 (64.02/39.24) EITDIPDFADIPDSKET.NEGDAIKKEEEKepKTQVGETNSEVKDS
---------------------------------------------------------------------------
|