<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20735
| Description |
Uncharacterized protein |
| Sequence | MASADLVTQLQDQLHTVSKMFFDFVGILQRDAPPLPLDGEPLAPPPTAVTAAASAAAPGDGGPPAFDVEATTQLMASQLIAQFKATEALISALPPAPGPDGAAASDRARALQEEHAAVSAALDAAAAEAEAQLGELQRLFAELAAARLRDARAGVALPPLPAVD |
| Length | 164 |
| Position | Middle |
| Organism | Raphidocelis subcapitata |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Chlorophyta> core chlorophytes> Chlorophyceae>
CS clade> Sphaeropleales> Selenastraceae> Raphidocelis.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | 0.157 |
| Instability index | 44.28 |
| Isoelectric point | 4.32 |
| Molecular weight | 16605.57 |
| Publications | PubMed=29795299
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP20735
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.04| 16| 20| 36| 54| 1
---------------------------------------------------------------------------
36- 51 (29.53/ 7.84) PLDGEPLAPPPTAVTA
58- 73 (27.51/10.11) PGDGGPPAFDVEATTQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 112.35| 27| 62| 74| 100| 2
---------------------------------------------------------------------------
74- 100 (45.10/15.19) LMASQLIAQFKATEALIS..............ALPPAPGPD
102- 123 (32.72/ 9.55) AAASDRARALQEEHAAVS..............A.....ALD
124- 164 (34.53/10.38) AAAAEAEAQLGELQRLFAelaaarlrdaragvALPPLPAVD
---------------------------------------------------------------------------
|