<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20731
| Description |
Uncharacterized protein |
| Sequence | MVGPRQSRHPELAQALARVQDVRHGVEEVLDACAGLPGSAPRVSARLHGVGSAVDALHALWPQLEDGGLLASGAAAARCEGDGAAGIAAGGGEQQEEALGEQQAPQQRPGARPAASPAPLALRDAVTAALPELGAPAKRQRLAGGGPGRWQYADRLLAVVEAVRTAAPGLQVELMNSFSNTRAHHPRQADEVRVLCPGVFCAAVAIAGGGRTQPVRVAVDAADAAPNAHAWATSQHQCFRRISALAALAAVHFSCGAAARQLLSTPAVSGGGGGGGGGAAGGLDGSGSGGDGGAGAAGLDALECLLLWLASYSDLFSRPCAVTGTLLCWEPASEVPLPPLVRPFKLSREQLAAAAGDPGLRMAWHAHAAPRDALLPRPPATGSGARTDDGDALSGLLQ |
| Length | 398 |
| Position | Tail |
| Organism | Raphidocelis subcapitata |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Chlorophyta> core chlorophytes> Chlorophyceae>
CS clade> Sphaeropleales> Selenastraceae> Raphidocelis.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.016 |
| Instability index | 48.62 |
| Isoelectric point | 6.26 |
| Molecular weight | 39991.59 |
| Publications | PubMed=29795299
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP20731
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.24| 14| 15| 270| 284| 1
---------------------------------------------------------------------------
270- 284 (26.53/ 9.87) GGGGGGGGGAAgGLD
287- 300 (30.72/ 8.69) GSGGDGGAGAA.GLD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 83.90| 25| 28| 98| 124| 2
---------------------------------------------------------------------------
98- 124 (40.85/19.12) ALGEQQAPQQRPgaRPA.ASPAPLALRD
129- 154 (43.05/15.80) ALPELGAPAKRQ..RLAgGGPGRWQYAD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 67.36| 20| 22| 18| 37| 3
---------------------------------------------------------------------------
18- 37 (36.68/19.12) RVQDVRHGVEEVLDACAGL.P
42- 62 (30.68/14.92) RVSARLHGVGSAVDALHALwP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.08| 16| 56| 308| 324| 4
---------------------------------------------------------------------------
308- 324 (29.14/20.27) WLASYS..D.LFSRPCAvTG
364- 382 (24.94/12.37) WHAHAAprDaLLPRPPA.TG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 63.67| 17| 115| 79| 95| 5
---------------------------------------------------------------------------
79- 95 (33.34/14.54) CEGDGAAGIA.AGGGEQQ
196- 213 (30.34/12.57) CPGVFCAAVAiAGGGRTQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 31.64| 10| 22| 216| 225| 6
---------------------------------------------------------------------------
216- 225 (16.15/ 7.98) RVAVDAADAA
241- 250 (15.49/ 7.35) RISALAALAA
---------------------------------------------------------------------------
|