<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20727
| Description |
Putative mediator of RNA polymerase II transcription subunit 30-like |
| Sequence | MAASLPQKPGMAGMPPQQQQPHLPPGGASAQGQQPMPPQGALREISPVFLCRIGQETVQDIVTRTMEIFQITRATQLPNGVTQSQAMYQDRFGKLQEHLRQLALLFRKLRLLYERCVEMTSDLQEGPAEIVPYVGEELLSVKVEPCSSAVNQERKQVLEKVRQKNQEMKVLMDQMRNLLWDVNAMLTHRK |
| Length | 190 |
| Position | Head |
| Organism | Scophthalmus maximus (Turbot) (Psetta maxima) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata>
Carangaria> Pleuronectiformes> Pleuronectoidei> Scophthalmidae>
Scophthalmus.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.472 |
| Instability index | 54.71 |
| Isoelectric point | 8.84 |
| Molecular weight | 21544.82 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP20727
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 65.43| 16| 19| 10| 25| 1
---------------------------------------------------------------------------
10- 25 (33.94/14.88) GMAGMPPQQQQPHLPP
32- 47 (31.49/13.39) GQQPMPPQGALREISP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.06| 15| 17| 48| 64| 2
---------------------------------------------------------------------------
48- 64 (20.51/21.60) VFlcRIGQET.VQDIVTR
68- 83 (21.55/13.75) IF..QITRATqLPNGVTQ
---------------------------------------------------------------------------
|