<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20716
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MQRLTLEHLNQMVGVEYILLHAQEPILYIIRKQQRQSPTQVIPFADYYIIAGVVYQAPDLGTVINSRALSAVHGIQSAFDEAMSYCRYHPSKGYWWHFKDQEEREKAKPKSKKKEEPSSLFQRHRVDTLLLDLRSKFPPTFYQPKPGEKPIPVEVKKEPEPPTETVKQEEREPATKSSAPAPPSKPPPEKRARLQ |
| Length | 195 |
| Position | Head |
| Organism | Scophthalmus maximus (Turbot) (Psetta maxima) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata>
Carangaria> Pleuronectiformes> Pleuronectoidei> Scophthalmidae>
Scophthalmus.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.817 |
| Instability index | 61.48 |
| Isoelectric point | 9.28 |
| Molecular weight | 22526.55 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP20716
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 40.28| 16| 19| 145| 162| 1
---------------------------------------------------------------------------
150- 171 (15.83/ 8.92) PiPVEVKKEPEPPtetvKQeER
172- 190 (24.44/ 7.42) E.PATKSSAPAPP.skpPP.EK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 41.02| 11| 18| 28| 38| 2
---------------------------------------------------------------------------
28- 38 (20.77/14.66) YIIRKQQRQSP
48- 58 (20.25/14.12) YIIAGVVYQAP
---------------------------------------------------------------------------
|