Description | Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MQRLTLEHLNQMVGVEYILLHAQEPILYIIRKQQRQSPTQVIPFADYYIIAGVVYQAPDLGTVINSRALSAVHGIQSAFDEAMSYCRYHPSKGYWWHFKDQEEREKAKPKSKKKEEPSSLFQRHRVDTLLLDLRSKFPPTFYQPKPGEKPIPVEVKKEPEPPTETVKQEEREPATKSSAPAPPSKPPPEKRARLQ |
Length | 195 |
Position | Head |
Organism | Scophthalmus maximus (Turbot) (Psetta maxima) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata> Carangaria> Pleuronectiformes> Pleuronectoidei> Scophthalmidae> Scophthalmus. |
Aromaticity | 0.09 |
Grand average of hydropathy | -0.817 |
Instability index | 61.48 |
Isoelectric point | 9.28 |
Molecular weight | 22526.55 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 PIRNR:PIRNR023869 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP20716 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 40.28| 16| 19| 145| 162| 1 --------------------------------------------------------------------------- 150- 171 (15.83/ 8.92) PiPVEVKKEPEPPtetvKQeER 172- 190 (24.44/ 7.42) E.PATKSSAPAPP.skpPP.EK --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 41.02| 11| 18| 28| 38| 2 --------------------------------------------------------------------------- 28- 38 (20.77/14.66) YIIRKQQRQSP 48- 58 (20.25/14.12) YIIAGVVYQAP --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) IPVEVKKEPEPPTETVKQEEREPATKSS 2) PSKPPPEKRARLQ | 151 183 | 178 195 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab