<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20712
Description |
Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MGEPQQVSALPPPPMQYIKEYTDENIRKGLAPKPPPPIRDNYMMFGNQFQCDDLIIRPLESQGIERLHPMQFDHKRELKKLNMSILVNFLDLLDILIKSPGSIKREEKLEDLKLLFVHMHHLINEYRPHQARETLRVMMEVQKRQRLETAERFQKHLERVVEMIQGCLTSLPDDLPQMEGPEGAGDGARSVSVEASTGCSSGQAPRLKSEPMDVEEAGASCMAAAQQDKSIPPPKREKIWDKDAAMCSIIDEIA |
Length | 254 |
Position | Middle |
Organism | Scophthalmus maximus (Turbot) (Psetta maxima) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata>
Carangaria> Pleuronectiformes> Pleuronectoidei> Scophthalmidae>
Scophthalmus.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.572 |
Instability index | 48.38 |
Isoelectric point | 5.59 |
Molecular weight | 28863.01 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 RuleBase:RU364060
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP20712
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 70.36| 20| 26| 11| 33| 1
---------------------------------------------------------------------------
11- 30 (39.69/27.46) PPPP.....MQYIKEYT.DENIRKGL
34- 59 (30.67/12.55) PPPPirdnyMMFGNQFQcDDLIIRPL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.09| 16| 26| 75| 92| 2
---------------------------------------------------------------------------
75- 92 (21.28/26.71) KRELKKLNMSILvnFLDL
104- 119 (26.80/23.56) KREEKLEDLKLL..FVHM
---------------------------------------------------------------------------
|