<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20711

Description Putative mediator of RNA polymerase II transcription subunit 26
SequenceMTAAPATPQVMRDRLLQAIDGQSNQISNMVVVMEVISFLEKYPITKEALEETRLGKLINDVRKQTKNEDLAKRAKKLLRTWQKLIEPGKGEVLSKERTGASWSSSGGAHPCISATAAPTPSGKTGQELKNRNDFNNCYSPRMEKPGNRKRKGEQKEGQLLPAKISKTTLGDKIQNPKQLPTNGIGSSSEIFTDARTRQPLDKDISEPSDNDRLHKIPVNAVKPHPSALVYSKPLSASSLLKASVLQQQARQEQFASGGQHRPKSPRFSLHSPQPKQEAVVKQITQAQSGANLSSPSVRTGSVDTFGLGPSPQPSNVCVQGLHTDGSLSADLDFQGRPPNTSLHSSTPSSFSDGVSFEDDGAFGITGKRKRQKYRPKDCAVNLDGQTLGDSTKPVRLKDRRLTFDPVTGQIKPSFHKEPCQEKEASLGHIPEPQWPEQPKQNPPIAPSPFQQTDWKELSRSDIIQSYLSQQSNVLTSSGTHTPGAHFFMSEFLKKEEHRSNDAKETHRVAPEQPAKDLPGVSREINDEDLCRLHAQHWSGVNGCYDTKGNWYDWTECMSLDPHGDENRLNILPYVCLD
Length577
PositionUnknown
OrganismScophthalmus maximus (Turbot) (Psetta maxima)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata> Carangaria> Pleuronectiformes> Pleuronectoidei> Scophthalmidae> Scophthalmus.
Aromaticity0.05
Grand average of hydropathy-0.840
Instability index50.35
Isoelectric point8.91
Molecular weight63761.73
Publications









Function






Annotated function


GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP20711
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     102.39|      30|      36|     267|     298|       1
---------------------------------------------------------------------------
  267-  296 (52.27/27.70)	FSL.HSPQPKQEAVVKQITQAQSGANLSSPS
  305-  335 (50.12/27.65)	FGLgPSPQPSNVCVQGLHTDGSLSADLDFQG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      75.17|      23|      37|     336|     358|       4
---------------------------------------------------------------------------
  336-  358 (40.78/21.28)	RPPN..TSLHSSTPSSFSDGVSFED
  374-  398 (34.39/16.89)	RPKDcaVNLDGQTLGDSTKPVRLKD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     118.89|      27|     166|     240|     266|       5
---------------------------------------------------------------------------
  240-  266 (47.88/27.08)	LKASVLQQQARQEQFASGGQH.....RPKSPR
  410-  439 (42.46/23.20)	IKPS.FHKEPCQEKEASLG.HipepqWPEQPK
  463-  482 (28.54/13.25)	IQ.SYLSQQS..NVLTSSGTH.....TP....
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP20711 with Med26 domain of Kingdom Metazoa
Unable to open file!