<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20710
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MTEMFSTLYGQNEAQAPPGASSLGFGPGKPPPPLQQNQASMPGQMPPQLGDEGPALRKPGAMNEPFYLLRELPVGNELTGNTNLITHYNLEHAYNKFCGKKVKEKLSNFLPELPGMIDCPGTQDGSSLRSLIDKPPVCGNSFSPLTGALLTGFRLHTGPLPEQYRLMHIQPPKKKSKHKHKHHRPQDPLPQETPSDSDPKKKKKKRDDDPDRKKKKKDKKKKKNRHSPDHPGLAGSQPNSNSLR |
| Length | 244 |
| Position | Head |
| Organism | Scophthalmus maximus (Turbot) (Psetta maxima) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata>
Carangaria> Pleuronectiformes> Pleuronectoidei> Scophthalmidae>
Scophthalmus.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -1.127 |
| Instability index | 52.98 |
| Isoelectric point | 9.74 |
| Molecular weight | 27048.62 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP20710
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 69.38| 14| 17| 198| 212| 1
---------------------------------------------------------------------------
178- 190 (21.76/ 7.32) ..HKHKHHRPQDPLP
198- 212 (22.15/12.26) DpKKKKKKRDDDPDR
218- 230 (25.47/ 9.92) D.KKKKKNR.HSPDH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 140.76| 43| 75| 47| 92| 3
---------------------------------------------------------------------------
47- 92 (72.18/52.11) PQLGDeGPALR....KPGAMNEPFYLLRE.LPVGNEL.TGntNLITHYNLEH
120- 168 (68.58/39.67) PGTQD.GSSLRslidKPPVCGNSFSPLTGaLLTGFRLhTG..PLPEQYRLMH
---------------------------------------------------------------------------
|