<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20704
Description |
GL18568 product from transcript GL18568-RA |
Sequence | MLRSPNKTNAMKQWEQRWIKNCLCGDLDSPDQTWTHLDSPGLTLSDLDSPDQTWTHLDSPHQTWTHLDSPDQTWTHLIRPGLTWTHLIRPGLTWTHLDSPYQTWTHLIRPGLTSSDLDSPGLTLSDLDSPDQTWTHLDSPYQTCTHLISPDHT |
Length | 153 |
Position | Tail |
Organism | Scophthalmus maximus (Turbot) (Psetta maxima) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata>
Carangaria> Pleuronectiformes> Pleuronectoidei> Scophthalmidae>
Scophthalmus.
|
Aromaticity | 0.08 |
Grand average of hydropathy | -0.805 |
Instability index | 53.11 |
Isoelectric point | 5.16 |
Molecular weight | 17608.22 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP20704
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
7| 252.34| 18| 18| 34| 51| 1
---------------------------------------------------------------------------
14- 31 (31.80/10.63) WEQRWIKNCLCGDLDSPD
34- 51 (42.68/16.13) WTHLDSPGLTLSDLDSPD
54- 71 (44.39/16.99) WTHLDSPHQTWTHLDSPD
84- 101 (43.78/16.69) WTHLIRPGLTWTHLDSPY
104- 116 (23.01/ 6.19) WTHLIRPGLTSSD.....
118- 131 (25.08/ 7.24) ....DSPGLTLSDLDSPD
134- 151 (41.61/15.59) WTHLDSPYQTCTHLISPD
---------------------------------------------------------------------------
|