<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20701
Description |
Putative mediator of RNA polymerase II transcription subunit 22 isoform 6 |
Sequence | MATQRVLPQSKETLLQNYNKRLKDDIRSILDNFTEIIKTAKIEDETQVSRATQAEQDHYEMHVRAANIVRAGESLMKLVSDLKQFLILNDFPSVNDAISLQNQHLRSLQEECDKKLTSLRDEIAIDLYELEEEYYSSRYK |
Length | 140 |
Position | Head |
Organism | Scophthalmus maximus (Turbot) (Psetta maxima) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata>
Carangaria> Pleuronectiformes> Pleuronectoidei> Scophthalmidae>
Scophthalmus.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.669 |
Instability index | 73.10 |
Isoelectric point | 5.12 |
Molecular weight | 16394.29 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP20701
No repeats found
No repeats found
|