| Description | Putative mediator of RNA polymerase II transcription subunit 22 isoform 4 |
| Sequence | MKCTSEQLTFPCTLSVSSYQVRAGESLMKLVSDLKQFLILNDFPSVNDAISLQNQHLRSLQEECDKKLTSLRDEIAIDLYELEEEYYSSSYSQWDSTDLPLCEVYRQRDSWASPGSSCSSTQGDREDMDGPPSQETNSQQHLNGHGTASIEKP |
| Length | 153 |
| Position | Head |
| Organism | Scophthalmus maximus (Turbot) (Psetta maxima) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata> Carangaria> Pleuronectiformes> Pleuronectoidei> Scophthalmidae> Scophthalmus. |
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.727 |
| Instability index | 65.21 |
| Isoelectric point | 4.45 |
| Molecular weight | 17266.77 |
| Publications |
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats | >MDP20698 No repeats found No repeats found |
| MoRF Sequence | Start | Stop |
| 1) TDLPL 2) YYSSSY | 97 86 | 101 91 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab