<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20692
Description |
Mediator of RNA polymerase II transcription subunit 31 |
Sequence | METEEQARNRFQSELEFIQCLANPNYLNFLAQRGFLRERPFINYLKYLLYWKEPEYAKFLKYPHCLHMLELLQYEHFRKELVNAQCAKFIDEQQLLHWQHYSRKRTRLQQALAEQQQQQPQQPPHGNAAAK |
Length | 131 |
Position | Middle |
Organism | Scophthalmus maximus (Turbot) (Psetta maxima) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata>
Carangaria> Pleuronectiformes> Pleuronectoidei> Scophthalmidae>
Scophthalmus.
|
Aromaticity | 0.14 |
Grand average of hydropathy | -0.878 |
Instability index | 55.99 |
Isoelectric point | 8.78 |
Molecular weight | 16025.10 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP20692
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 92.25| 21| 21| 56| 76| 1
---------------------------------------------------------------------------
26- 49 (29.67/13.02) YLNFLAQRGFLRerpFIN...YLKYLL
56- 76 (39.65/19.14) YAKFLKYPHCLH...MLE...LLQYEH
83- 100 (22.93/ 8.88) NAQ......CAK...FIDeqqLLHWQH
---------------------------------------------------------------------------
|