<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20643
| Description |
Mediator of RNA polymerase II transcription subunit 16 |
| Sequence | MVVIRIWGLLKPSCLPVYTATSDTQDSMSLLFRLLTKLWICCRDEGPTSEPDEALVDECCLLPSQLLIPSLDWLPVSDGLVSRLQPKQPLRLHFGKPPALPGSATSLQLDGLIRAPGQPKMDHLRRLHLGAYPTEACKACTRCGCVTMLKSPNKTTAVKQWEQRWIKNCLCGGLWWRMPLSYP |
| Length | 183 |
| Position | Tail |
| Organism | Tursiops truncatus (Atlantic bottle-nosed dolphin) (Delphinus truncatus) |
| Kingdom | Metazoa |
| Lineage | |
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.075 |
| Instability index | 68.72 |
| Isoelectric point | 8.80 |
| Molecular weight | 20497.01 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP20643
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 59.67| 18| 21| 79| 97| 1
---------------------------------------------------------------------------
79- 97 (28.27/21.68) GLVSRLQPKQPLRLHfGKP
102- 119 (31.40/18.78) GSATSLQLDGLIRAP.GQP
---------------------------------------------------------------------------
|