<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20626
Description |
mediator of RNA polymerase II transcription subunit 30 isoform X1 |
Sequence | MSTPPLAASGMAPGPFAGPQAQQAAREVNTASLCRIGQETVQDIVYRTMEIFQLLRNMQLPNGVTYHTGTYQDRLAKLQDHLRQLSILFRKLRLVYDKCNENCGGMDPIPVEQLIPYVEDDGSKNDDRAGPPRFASEERREIAEVNKMEALKDLKLKQKNQQLKQIMDQLRNLIWDINAMLAMRS |
Length | 185 |
Position | Head |
Organism | Tursiops truncatus (Atlantic bottle-nosed dolphin) (Delphinus truncatus) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Laurasiatheria> Artiodactyla> Whippomorpha> Cetacea> Odontoceti>
Delphinidae> Tursiops.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.551 |
Instability index | 44.69 |
Isoelectric point | 7.69 |
Molecular weight | 21043.97 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP20626
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.51| 14| 31| 139| 152| 1
---------------------------------------------------------------------------
139- 152 (22.72/17.13) RREIAEVNKMEALK
171- 184 (25.79/20.28) RNLIWDINAMLAMR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.55| 16| 34| 42| 60| 2
---------------------------------------------------------------------------
42- 60 (18.83/25.09) QDIVyRTMEIfqLLRNMQL
79- 94 (27.72/18.82) QDHL.RQLSI..LFRKLRL
---------------------------------------------------------------------------
|