<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20619
| Description |
mediator of RNA polymerase II transcription subunit 9 isoform X1 |
| Sequence | MASVGVSVGRQAEDALQPPAEPPLPETKPLPPPQPPPPVSAPQPQPPPRPPSPAGVKAEENCSFLPLVHNIIKWSPRACWTWQRRVGGPHAGSAFTFIWGARLELAQGSSRPVSRTPSPQGLFPHMCRFQSAQQPASRGLALGPDGQEVTPRLTCSSSALPCLLC |
| Length | 165 |
| Position | Middle |
| Organism | Tursiops truncatus (Atlantic bottle-nosed dolphin) (Delphinus truncatus) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Laurasiatheria> Artiodactyla> Whippomorpha> Cetacea> Odontoceti>
Delphinidae> Tursiops.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.375 |
| Instability index | 84.06 |
| Isoelectric point | 9.18 |
| Molecular weight | 17538.95 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP20619
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 65.63| 15| 16| 18| 32| 1
---------------------------------------------------------------------------
18- 32 (32.00/ 9.94) PPAEPPLPETKPLPP
37- 51 (33.63/10.83) PPVSAPQPQPPPRPP
---------------------------------------------------------------------------
|