Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MENFSALFGAQADPPPPPTALSLGPGKPPPPPPPPPGGGPGSAPPPXKSAAGCGPFYLMRELPGSTQLTGSTNLITHYNLEHSYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILGGSFNPITGTMLAGFRLHTGLLPEQCRLMHIQPPKKKNKHKYKQSRTQDPVPPETPSDSDHKKKKKKKEEDPERKRKKKEKKKKKNRHSPDHPGVGSSQASSSSSL |
Length | 234 |
Position | Head |
Organism | Odobenus rosmarus divergens (Pacific walrus) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Laurasiatheria> Carnivora> Caniformia> Odobenidae> Odobenus. |
Aromaticity | 0.05 |
Grand average of hydropathy | -1.007 |
Instability index | 62.83 |
Isoelectric point | 9.86 |
Molecular weight | 25259.69 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP20591 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 66.47| 16| 16| 181| 196| 1 --------------------------------------------------------------------------- 163- 184 (21.96/ 8.43) KKKNKHKYKQSRtqdpvpPETP 185- 203 (20.31/ 7.31) SDSDHKKKKKKK...eedPERK 204- 221 (24.19/ 9.94) RKKKEKKKKKNR....hsPDHP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 143.95| 44| 46| 59| 104| 3 --------------------------------------------------------------------------- 59- 102 (79.03/48.79) MRELPGSTQLTGSTNLITHYN.LEHSYNKFCGKKVKE.KL.SNFLPD 106- 152 (64.92/33.37) MIDLPGSHDNSSLRSLIEKPPiLGGSFNPITGTMLAGfRLhTGLLPE --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) MAAFGI 2) NIFGRY 3) QQILRQQQ 4) QQQQYHIRQQ | 1 2169 2089 2074 | 6 2174 2096 2083 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab