<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20584
| Description |
Mediator of RNA polymerase II transcription subunit 16 |
| Sequence | MLRELMVVIRIWGLLKPSCLPVYTATSDTQDSMSLLFRLLTKLWICCRDEGPTSEPDEALVDECCLLPSQLLIPSLDWLPVSDGLVSRLQPKQPLRLHFGRAPTLPASASTLQLDGLVRCVPPLPRGLRLRRASRCSLALIVTLAPGDILARPVMALPPIHACTWASVCVTVPPVSPCVECRVAGV |
| Length | 186 |
| Position | Tail |
| Organism | Leptonychotes weddellii (Weddell seal) (Otaria weddellii) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Laurasiatheria> Carnivora> Caniformia> Phocidae> Leptonychotes.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | 0.409 |
| Instability index | 64.39 |
| Isoelectric point | 8.34 |
| Molecular weight | 20281.00 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364149
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP20584
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 97.81| 23| 30| 83| 105| 1
---------------------------------------------------------------------------
58- 82 (32.01/17.06) EALVDEccLLPSQL..LIPSLDWLPVS
83- 105 (43.36/25.87) DGLVSR..LQPKQP..LRLHFGRAPTL
115- 133 (22.44/ 9.64) DGLV.R..CVPPLPrgLRLR..RA...
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 26.93| 8| 30| 134| 146| 2
---------------------------------------------------------------------------
134- 146 (10.09/12.03) SRCslaliVTLAP
167- 174 (16.84/ 6.70) SVC.....VTVPP
---------------------------------------------------------------------------
|