<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20578
| Description |
cyclin-dependent kinase 8-like |
| Sequence | MDYDFKVKLSSERERVEDLFEYEGCKVGRGTYGHVYKAKRKDGKDDKDYALKQIEGTGISMSACREIALLRELKHPNVISLQKVFLSHADRKVWLLFDYAEHDLWHIIKFHRASKANKKPVQLPRGMVKSLLYQILDGIHYLHANWVLHRDLKPANILVMGEGPERGRVKIADMGFARLFNSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAI |
| Length | 215 |
| Position | Kinase |
| Organism | Leptonychotes weddellii (Weddell seal) (Otaria weddellii) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Laurasiatheria> Carnivora> Caniformia> Phocidae> Leptonychotes.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.358 |
| Instability index | 34.74 |
| Isoelectric point | 9.42 |
| Molecular weight | 24870.66 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | ATP binding GO:0005524 IEA:UniProtKB-UniRule
protein serine/threonine kinase activity GO:0004674 IEA:UniProtKB-KW
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP20578
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.44| 15| 35| 151| 165| 3
---------------------------------------------------------------------------
151- 165 (26.77/16.69) DLKPANILVMGEGPE
189- 203 (28.67/18.29) DLDPVVVTFWYRAPE
---------------------------------------------------------------------------
|