Description | Mediator of RNA polymerase II transcription subunit 9 |
Sequence | MASGGVAAGRQAEDALPPPAEPPLPETKPLPPSQPPPPVAAPQPQQSPAPRPQSPAGVKEEENYSFLPLVHNIIKCMDKDSPDIHQDLNALKTKFQELRKVVSTMPGTHLSPEQQERQLHSLREQVRTKNELLQKYKSLCMFEIPKE |
Length | 147 |
Position | Middle |
Organism | Leptonychotes weddellii (Weddell seal) (Otaria weddellii) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Laurasiatheria> Carnivora> Caniformia> Phocidae> Leptonychotes. |
Aromaticity | 0.03 |
Grand average of hydropathy | -0.805 |
Instability index | 98.50 |
Isoelectric point | 6.43 |
Molecular weight | 16293.45 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364145 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP20566 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 63.44| 15| 16| 17| 31| 1 --------------------------------------------------------------------------- 17- 31 (31.90/10.48) PPPAEPPLPETKPLP 36- 50 (31.54/10.30) PPPVAAPQPQQSPAP --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) PQSPAGVKEEENYSFLPLVHNII 2) RQAEDAL | 52 10 | 74 16 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab