<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20547

Description mediator of RNA polymerase II transcription subunit 14-like
SequenceMAPVQLENHQLVPPGGGGGAPGGPASAPAPPPPGAAVAAAAAAAASPGYRLSTLIEFLLHRAYSELMVLTDLLPRKSDVERKIEIVQFASRTRQLFVRLLALVKWANNAGKVEKCAMISSFLDQQAILFVDTADRLASLARDALVHARLPSFAIPYAIDVLTTGSYPRLPTCIRDKIIPPDPITKIEKQATLHQLNQILRHRLVTTDLPPQLANLTVANGRVKFRVEGEFEATLTVMGDDPDVPWRLLKLEILVEDKETGDGRALVHSMQINFIHQLVQSRLFADEKPLQDMYNCLHSFCLSLQLEVLHSQTLMLIRERWGDLVQVERYHAGKCLSLSVWNQQVLGRKTGTASVHKVTIKIDENDVSKPLQIFHDPPLPASDSKLVERAMKIDHLSIEKLLIDSVHARAHQKLQELKAILRGFNANENYECGYVSLSNLEIPHQGVQMEGDGFSHAIRLLKIPPCKGVNEETQKALDRSLLDCTFRLQGRNNRTWVAELVFANCPLNGTSTREQGPSRHVYLTYENLLSEPVGGRKVVEMFLNDWNSIARLYECVLEFARSLPDIPAHLNIFSEVRVYNYRKLILCYGTTKGSSISIQWNSIHQKFHISLGTVGPNSGCSNCHNTILHQLQEMFNKTPNVVQLLQVLFDTQAPLNAINKLPTVPMLGLTQRTNTAYQCFSILPQSSTHIRLAFRNMYCIDIYCRSRGVVAIRDGAYSLFDNSKLVEGFYPAPGLKTFLNMFVDSNQDARRRSVNEDDNPPSPIGGDMMDSLISQLQPPPQQQPFPKQPGSSGAYPLTSPPTSYHSTVNQSPSMMHTQSPGNLHAASSPSGALRAPSPASFVPTPPPSSHGISIGPGASFASPH
Length863
PositionTail
OrganismLeptonychotes weddellii (Weddell seal) (Otaria weddellii)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Laurasiatheria> Carnivora> Caniformia> Phocidae> Leptonychotes.
Aromaticity0.07
Grand average of hydropathy-0.194
Instability index48.07
Isoelectric point8.35
Molecular weight95373.28
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


ECO:0000256	RuleBase:RU365082

GO - Cellular Component
mediator complex	GO:0016592	IEA:UniProtKB-UniRule

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:UniProtKB-UniRule

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP20547
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      44.91|      14|      18|     804|     819|       1
---------------------------------------------------------------------------
  804-  819 (23.61/19.25)	HSTvnQSPS.MMHTQSP
  823-  837 (21.30/10.46)	HAA..SSPSgALRAPSP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      82.42|      18|      18|     762|     779|       2
---------------------------------------------------------------------------
   10-   27 (31.12/13.02)	QLVPPG...GGGG...APGGPASA
  774-  794 (29.92/12.24)	QLQPPPqqqPFPK...QPGSSGAY
  843-  861 (21.39/ 6.66)	..TPPP...SSHGisiGPGASFAS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     120.87|      30|      31|     246|     275|       3
---------------------------------------------------------------------------
  246-  267 (20.97/ 6.76)	........RLLKLEILVEDKETGDGRAL....VH
  268-  297 (54.16/26.09)	SMQINFIHQLVQSRLFADEKPLQDMYNC....LH
  596-  628 (45.74/21.19)	SIQWNSIHQKFHISL.GTVGPNSGCSNChntiLH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     109.90|      31|      31|     112|     142|       4
---------------------------------------------------------------------------
   79-   97 (19.21/ 8.47)	......................VERKIEIVQF.....ASRTRQLFV
   98-  130 (33.58/20.39)	....RLLALVKW....annagkVEKCAMISSF.....LDQQAILFV
  131-  163 (30.14/17.54)	DTADRLASLARD........alVH..ARLPSFaipyaID...VLTT
  164-  197 (26.97/14.91)	GSYPRLPTCIRDkiippdpitkIEKQATLHQ......LNQ......
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      35.23|      12|      68|     302|     313|       5
---------------------------------------------------------------------------
  302-  313 (19.73/11.81)	SLQLEVLHS.QTL
  323-  335 (15.50/ 7.80)	LVQVERYHAgKCL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      44.88|      13|      17|     362|     374|       8
---------------------------------------------------------------------------
  362-  374 (23.09/15.61)	DENDVSKPLQIFH
  382-  394 (21.79/14.33)	DSKLVERAMKIDH
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP20547 with Med14 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) NQDARRRSVNEDDNPPSPIGGDMMDSLISQLQPPPQQQPFPKQPGSSGAYPLTSPPTSYHSTVNQSPSMMHTQSPGNLHAASSPSGALRAPSPASFVPTPPPSSHGISIGPGASFASPH
2) VQLENHQLVPPGGGGGAPGGPASAPAPPPP
745
4
863
33










Molecular Recognition Features






MoRF SequenceStartStop




NANANA