<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20540
Description |
mediator of RNA polymerase II transcription subunit 27 |
Sequence | MADVLSVGVNLEAFAQAISAIQALRSSVSRVFDCLKDGMRNKETLEGREKAFIAHFQDNLHSVNRDLNELERLSNLVGKPSENHPLHNSGLLSLDPVQDKTPLYSQLLQAYKWSNKKELLSIPRTFSWQV |
Length | 130 |
Position | Tail |
Organism | Leptonychotes weddellii (Weddell seal) (Otaria weddellii) |
Kingdom | Metazoa |
Lineage | |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.363 |
Instability index | 31.76 |
Isoelectric point | 6.91 |
Molecular weight | 14675.50 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP20540
No repeats found
No repeats found
|