<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20537
Description |
Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MAAVDIRDNLLGISWVDSSWIPILNSGSVLDYFSERSNPFYDRTCNNEVVKMQRLTLEHLNQMVGVEYILLHAQEPILFIIRKQQRQSPTQVIPLADYYIIAGVIYQAPDLGSVINSRVLTAVHGIQSAFDEALSYCRYHPSKGYWWHFKDHEEQAKVWRKACPSGSDKERGRTYTRNCKI |
Length | 181 |
Position | Head |
Organism | Leptonychotes weddellii (Weddell seal) (Otaria weddellii) |
Kingdom | Metazoa |
Lineage | |
Aromaticity | 0.11 |
Grand average of hydropathy | -0.327 |
Instability index | 38.78 |
Isoelectric point | 7.70 |
Molecular weight | 20907.58 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP20537
No repeats found
No repeats found
|