<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20523
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MENFSALFGAQADPPPPPTALGFGPGKPPPPPPPPPGGGPGTAPPPTAATAPPCADKSAAGCGPFYLMRELPGSTELTGSTNLITHYNLEHSYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILGGSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPETPSDSDHKKKKKKKEEDPERKRKKKEKKKKKNRHSPDHPGVGSSQASSSSSLR |
| Length | 244 |
| Position | Head |
| Organism | Leptonychotes weddellii (Weddell seal) (Otaria weddellii) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Laurasiatheria> Carnivora> Caniformia> Phocidae> Leptonychotes.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -1.005 |
| Instability index | 63.53 |
| Isoelectric point | 9.79 |
| Molecular weight | 26291.78 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP20523
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 79.91| 16| 17| 190| 205| 2
---------------------------------------------------------------------------
170- 183 (25.73/10.48) P..PKKKNKHKHKQSR
190- 205 (27.40/11.58) PETPSDSDHKKKKKKK
209- 224 (26.77/11.17) PERKRKKKEKKKKKNR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 131.62| 40| 46| 68| 113| 4
---------------------------------------------------------------------------
68- 111 (68.72/51.07) MRELPGSTELTGSTNLITHYN.LEHSYNKFCGkkvkEKLSNF......LPD
115- 161 (62.90/32.87) MIDLPGSHDNSSLRSLIEKPPiLGGSFNPITG....TMLAGFrlhtgpLPE
---------------------------------------------------------------------------
|