<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20522
Description |
Mediator of RNA polymerase II transcription subunit 20 |
Sequence | MGVTCVSQMPVAEGKSVQQTVELLTRKLEMLGAEKQGTFCVDCETYHTAASALGSQGQAGKLMYVIHNSEYPLSCFALFENGPWLIADTNFDVLMVKLKGFFQSAKASKIETQGTCYQYCDFLVKVGTVTTGPSARGISVEVEYGRCVVASDCWSLLLKFLQSFLGNHTPGAPAVFGNRHDAVYGPADTMVQYMELFSKIRKQQQVPVAGIR |
Length | 212 |
Position | Head |
Organism | Leptonychotes weddellii (Weddell seal) (Otaria weddellii) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Laurasiatheria> Carnivora> Caniformia> Phocidae> Leptonychotes.
|
Aromaticity | 0.10 |
Grand average of hydropathy | 0.041 |
Instability index | 25.91 |
Isoelectric point | 6.88 |
Molecular weight | 23173.47 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364152
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP20522
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 168.12| 52| 60| 50| 102| 1
---------------------------------------------------------------------------
50- 102 (88.35/63.05) ASALGSQGQAGK....LMYVIHNSEYPlSCFAL...FENGPWLIADTNFDVLMVKLKGFF
107- 165 (79.77/52.35) ASKIETQGTCYQycdfLVKVGTVTTGP.SARGIsveVEYGRCVVASDCWSLLLKFLQSFL
---------------------------------------------------------------------------
|