<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20471
| Description |
mediator of RNA polymerase II transcription subunit 28 |
| Sequence | MAAPLGGMFSGQPPGPPPPPPGLLAQASLLQATPGVPRTSNSTLVDELESSFEACFASLVSQDYVNGTDQEEIRTGVDQCIQKFLDIARQTECFFLQKRLQLSVQKPEQVIKEDVSELRNELQRKDALVQKHLTKLRHWQQVLEDINMQHKKPADIPQGSLAYLEQASANIPAPMKQT |
| Length | 178 |
| Position | Head |
| Organism | Tursiops truncatus (Atlantic bottle-nosed dolphin) (Delphinus truncatus) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Laurasiatheria> Artiodactyla> Whippomorpha> Cetacea> Odontoceti>
Delphinidae> Tursiops.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.463 |
| Instability index | 57.72 |
| Isoelectric point | 5.39 |
| Molecular weight | 19715.24 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | nucleoplasm GO:0005654 IEA:Ensembl
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP20471
No repeats found
|