<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20470
Description |
Mediator of RNA polymerase II transcription subunit 11 |
Sequence | MATYSLANERLRALEDIEREIGAILQNAGTVILELSKEKTNERLLDRQAAAFTASVQHVEAELSAQIRYLTQVATGQPHEGSSYSSRKDCQMALKRVDYARLKLSEVARTCEQMLEN |
Length | 117 |
Position | Head |
Organism | Tursiops truncatus (Atlantic bottle-nosed dolphin) (Delphinus truncatus) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Laurasiatheria> Artiodactyla> Whippomorpha> Cetacea> Odontoceti>
Delphinidae> Tursiops.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.440 |
Instability index | 32.98 |
Isoelectric point | 5.72 |
Molecular weight | 13142.72 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364147
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP20470
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 72.53| 24| 31| 8| 36| 1
---------------------------------------------------------------------------
8- 36 (33.02/37.42) NERLraledIEREIGAILQNAGTVILELS
41- 64 (39.51/29.94) NERL.....LDRQAAAFTASVQHVEAELS
---------------------------------------------------------------------------
|