<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20469
Description |
mediator of RNA polymerase II transcription subunit 30 isoform X2 |
Sequence | MSTPPLAASGMAPGPFAGPQAQQAAREVNTASLCRIGQETVQDIVYRTMEIFQLLRNMQLPNGVTYHTGTYQDRLAKLQDHLRQLSILFRKLRLVYDKCNENCGGMDPIPVEQLIPYVEDDGSKNDDRAGPPRFASEERREIAEVNKKLKQKNQQLKQIMDQLRNLIWDINAMLAMRS |
Length | 178 |
Position | Head |
Organism | Tursiops truncatus (Atlantic bottle-nosed dolphin) (Delphinus truncatus) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Laurasiatheria> Artiodactyla> Whippomorpha> Cetacea> Odontoceti>
Delphinidae> Tursiops.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.575 |
Instability index | 45.17 |
Isoelectric point | 8.45 |
Molecular weight | 20243.01 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP20469
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.58| 21| 69| 77| 97| 1
---------------------------------------------------------------------------
77- 97 (35.66/18.20) KLQDHLRQLSILFRKLR.LVYD
148- 169 (32.91/16.44) KLKQKNQQLKQIMDQLRnLIWD
---------------------------------------------------------------------------
|