<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20441
| Description |
Transcription factor IIS |
| Sequence | MRIKEIVNNSPDESVSDLCDSLRKLQLMTISVETLKGTEIGKSVNVLRKHGSKDVRQIARSLIEMWKDMVDEWVNATQKMAGSEATPESMNPSVLDEEEGLPSPPLDDLAFLNPHSMSLELSEKFFDGMDDYGNPRKSSELNRNRSNGEKPPVEKQNITKWKQQKDTTVKPCKPLVADHTPKRVMKPNMDRKLQNHEKPVVPKRQVAQQQRKPTSSDGETVQDKLEATKRKLQERYQQAENAKRQRTIQVMELHDLPKQSIIAPKNQQMRPGNNHNRNWANGRF |
| Length | 284 |
| Position | Unknown |
| Organism | Artemisia annua (Sweet wormwood) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> campanulids> Asterales> Asteraceae> Asteroideae> Anthemideae>
Artemisiinae> Artemisia.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -1.075 |
| Instability index | 48.73 |
| Isoelectric point | 9.34 |
| Molecular weight | 32580.63 |
| Publications | PubMed=29703587
|
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP20441
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 110.01| 31| 45| 135| 165| 1
---------------------------------------------------------------------------
149- 196 (39.07/18.14) EKPPVEKQNITKWKQQK.......dttvkpckplvadhtP....KRvmKPNMD..RKLQNH
197- 249 (28.47/11.49) EKPVVPKRQVA..QQQRkptssdgetvqdkleatkrklqE....RY..QQAENakRQRTIQ
252- 282 (42.47/20.26) ELHDLPKQSIIAPK..........................nqqmRP..GNNHN..RNWANG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.39| 15| 19| 106| 121| 2
---------------------------------------------------------------------------
106- 121 (22.48/16.05) LDDL.AFLNPHSMSlEL
126- 141 (23.91/12.86) FDGMdDYGNPRKSS.EL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.94| 17| 204| 10| 26| 3
---------------------------------------------------------------------------
10- 26 (30.94/21.53) SPDESVSD.LCDSLRKLQ
216- 233 (25.00/16.16) SDGETVQDkLEATKRKLQ
---------------------------------------------------------------------------
|