<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20434
Description |
Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MLQNVPHQIIQSPARLGLPNPNSPSLQPPAPPKFPSQVTQSQQPNLHPNLLTTPTSLTLLPLLPPLSRAQSILLRMASLATKLFEVSPNATQWLATFHGSFPKFLPTQTANVTGSAPGSAKEIVALFATLQGQLFEAVTELQEILDLQDAKQKVTREIRARDAAVLAFANKLKEAERVLDMLVDDYSDFRRLKRLKGDDGEEGSSTTTVATQLNLNDILSYAHRISYTTFAPPEFGAGTAPLRGALPPAPQEEQMRASQLYAFADLDVGLPPENKEKFTIEPLAENPSEANPLANMGIMDMLPPNIVVPSGWKPGMPVQLPTDLSILPPAGWKPGDPVALPPLDALAAPPRIEEQQPQPAHVPGFARGPQPIQVRHVQLDIGADSSSEYSSDDDTSDDED |
Length | 400 |
Position | Middle |
Organism | Artemisia annua (Sweet wormwood) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> campanulids> Asterales> Asteraceae> Asteroideae> Anthemideae>
Artemisiinae> Artemisia.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.321 |
Instability index | 65.12 |
Isoelectric point | 4.82 |
Molecular weight | 43293.58 |
Publications | PubMed=29703587
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP20434
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 101.28| 18| 19| 303| 321| 1
---------------------------------------------------------------------------
19- 35 (34.30/ 9.16) PNPNSPS.LQPPAPPKFP
304- 321 (38.69/14.85) PNIVVPSGWKPGMPVQLP
326- 341 (28.28/ 8.12) ..ILPPAGWKPGDPVALP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.17| 17| 31| 230| 260| 2
---------------------------------------------------------------------------
230- 260 (17.08/31.45) FAPPEfgaGtaplrgalppaPQEEQMRASQL
363- 379 (31.09/13.13) PGFAR...G...........PQPIQVRHVQL
---------------------------------------------------------------------------
|