<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20431
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MAATPMMPPNLGPGNPNDGNAPAAPPPPGTDMTGICFRDQLWLNTYPLDRNLVFDYFALSPFYDYTCNNEQLRMRSIHPLDISHLSCFVLTDVKKSHTTNNLKVGSWFHLCFLFILPAIETLNPSVGAPFSFAFYCGRFACKLLFFKGVIGLLMVFAVGQTHLNQIMKLLVLTIGVCLRSVLGFLVSRPVVGYNRQMYSLSRYVYLHIILCWCTKKKKVPKIVAEILQITSYLGIYCKKPVSGYRLKDIGRGGIFVSGGENGVEEAAAATCTLSNPTGIWMYQMLESTTLDCCSDESMRWSKGAFFKEFFLRDDQRCINRRVT |
| Length | 323 |
| Position | Head |
| Organism | Artemisia annua (Sweet wormwood) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> campanulids> Asterales> Asteraceae> Asteroideae> Anthemideae>
Artemisiinae> Artemisia.
|
| Aromaticity | 0.12 |
| Grand average of hydropathy | 0.137 |
| Instability index | 42.55 |
| Isoelectric point | 8.95 |
| Molecular weight | 36304.17 |
| Publications | PubMed=29703587
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | integral component of membrane GO:0016021 IEA:UniProtKB-KW
mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP20431
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.00| 19| 23| 84| 105| 1
---------------------------------------------------------------------------
84- 105 (25.18/26.19) HLsCFVLtdVKKSHTTNNLKVG
109- 127 (34.82/22.17) HL.CFLF..ILPAIETLNPSVG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.48| 14| 48| 180| 193| 2
---------------------------------------------------------------------------
180- 193 (25.91/16.77) SVLGFLVSRPVVGY
231- 244 (28.56/19.20) SYLGIYCKKPVSGY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.74| 14| 29| 36| 49| 3
---------------------------------------------------------------------------
36- 49 (29.36/18.46) CFRDQLWL.NTYPLD
67- 81 (23.38/13.48) CNNEQLRMrSIHPLD
---------------------------------------------------------------------------
|