<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20428
| Description |
Mediator of RNA polymerase II transcription subunit 21 |
| Sequence | MDIISQLQEQVNTIAAISFNTFGTLQRDAPPDSLESLVLCKPIPPSYKPKYFDALVTALPLSEGGEEAQLKRIAELQAENDLVGQELQKQLEAAEIISLVKLCTSDSLVKHLYSNICFCASLEVVIPVGCVDLVQKLADSKTVQGSILAASKVLQFSNNENILFCSLLLAKWVDCVGSGNEKELKQVQELFNEAADNCLNMKKPDS |
| Length | 206 |
| Position | Middle |
| Organism | Artemisia annua (Sweet wormwood) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> campanulids> Asterales> Asteraceae> Asteroideae> Anthemideae>
Artemisiinae> Artemisia.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | 0.057 |
| Instability index | 37.83 |
| Isoelectric point | 4.61 |
| Molecular weight | 22502.66 |
| Publications | PubMed=29703587
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP20428
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.52| 16| 43| 115| 131| 2
---------------------------------------------------------------------------
115- 131 (28.46/20.32) NICFCaSLEVVIPVGCV
161- 176 (32.06/18.58) NILFC.SLLLAKWVDCV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.52| 15| 112| 65| 79| 4
---------------------------------------------------------------------------
65- 79 (24.58/18.03) GEEAQLKRIAELQAE
179- 193 (25.94/19.39) GNEKELKQVQELFNE
---------------------------------------------------------------------------
|