<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20418
| Description |
"Coactivator CBP, KIX domain-containing protein" |
| Sequence | MDASNLMPGQGASGVWVNAPMQFGDWRVELQADSRQRIVGKIMAALRRHLALDEYEIREMAMTFEEKIYAVATSQTLWNLNSFKKIGLQSDYLRKISLKMLTMEMRPQNLMPDPGADHKDGVVIDPPQENPTGSNQKTECCKCGNQAH |
| Length | 148 |
| Position | Tail |
| Organism | Artemisia annua (Sweet wormwood) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> campanulids> Asterales> Asteraceae> Asteroideae> Anthemideae>
Artemisiinae> Artemisia.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.525 |
| Instability index | 47.49 |
| Isoelectric point | 6.29 |
| Molecular weight | 16682.98 |
| Publications | PubMed=29703587
|
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | chromatin DNA binding GO:0031490 IEA:InterPro
transcription coactivator activity GO:0003713 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP20418
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 76.50| 20| 102| 1| 20| 1
---------------------------------------------------------------------------
1- 20 (40.23/21.84) MDASNLMPGQGA...SGVWVNAP
105- 127 (36.27/19.17) MRPQNLMPDPGAdhkDGVVIDPP
---------------------------------------------------------------------------
|