<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20417
Description |
"Coactivator CBP, KIX domain-containing protein" |
Sequence | MTLKGLFPVVNSLMEPGDSTLQLPSDARQRVVAKMINAMRRHLPLSEHEIQETAVMFEEKVYTVATSRPDYLRRISLKMLFVETRSENPMQDIVVSVLLNARMIILGVDHKDGVVVDPPQDNASGSNQPAKYCKCGDQAH |
Length | 140 |
Position | Tail |
Organism | Artemisia annua (Sweet wormwood) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> campanulids> Asterales> Asteraceae> Asteroideae> Anthemideae>
Artemisiinae> Artemisia.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.245 |
Instability index | 53.32 |
Isoelectric point | 6.41 |
Molecular weight | 15676.96 |
Publications | PubMed=29703587
|
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | chromatin DNA binding GO:0031490 IEA:InterPro
transcription coactivator activity GO:0003713 IEA:InterPro
|
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP20417
No repeats found
|