<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20414
| Description |
Mediator of RNA polymerase II transcription subunit 19a |
| Sequence | MDPESKKFGKGPRELTGAVDLISYYKLLPHHEFFCKKSLPLSISDTHYLHNVVGESEIRKGEGMQLDQLIQNTSFPRDTNTRILPFDMGILGEAFQLRETAPVDLPSSEKGTPTVAGKSKSESKDKEKKHRKHKDKDREKDREHKKHKHRHKDRSKDKDKEKKRDKSSNLDSGAESSKKHHEKKRKHDGDEDLNDIHRHKKSKHKSSKMDEMGAMKLTA |
| Length | 219 |
| Position | Head |
| Organism | Artemisia annua (Sweet wormwood) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> campanulids> Asterales> Asteraceae> Asteroideae> Anthemideae>
Artemisiinae> Artemisia.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -1.460 |
| Instability index | 38.09 |
| Isoelectric point | 9.56 |
| Molecular weight | 25278.26 |
| Publications | PubMed=29703587
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP20414
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.37| 15| 15| 132| 146| 1
---------------------------------------------------------------------------
132- 146 (28.44/11.79) KHKDKDREKDREHKK
148- 162 (25.93/10.11) KHRHKDRSKDKDKEK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 69.29| 21| 32| 61| 81| 2
---------------------------------------------------------------------------
61- 81 (37.77/26.37) GEGMQLDQL..IQNTSFPRDTNT
92- 114 (31.51/20.97) GEAFQLRETapVDLPSSEKGTPT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 35.65| 11| 37| 164| 174| 5
---------------------------------------------------------------------------
164- 174 (19.12/ 9.21) RDKSSNLDSGA
187- 197 (16.54/ 7.05) HDGDEDLNDIH
---------------------------------------------------------------------------
|