Description | Surfeit locus protein 5 subunit 22 of Mediator complex |
Sequence | MNKAGAGGGTSGASGPTAAAAATAAQKQKSLQQRVDNDIGSIIDNFSSVVNVARVNDPPVRNSQEAFMMEVRAARMVQAADSLLKLVSELKQTAIFSGFASLNDHVDKRTTELNQQAEKTDRVLARIGEEAAASLKEMESHYYSSVLRSNQHLQQ |
Length | 155 |
Position | Head |
Organism | Artemisia annua (Sweet wormwood) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> campanulids> Asterales> Asteraceae> Asteroideae> Anthemideae> Artemisiinae> Artemisia. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.427 |
Instability index | 39.21 |
Isoelectric point | 6.84 |
Molecular weight | 16619.36 |
Publications | PubMed=29703587 |
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP20406 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 130.91| 42| 50| 42| 85| 1 --------------------------------------------------------------------------- 42- 85 (64.27/49.96) IIDNFSSVVNvaRVNDPPVRNSQEAFMMEVRAARMVQAADSLLK 95- 136 (66.64/45.70) IFSGFASLND..HVDKRTTELNQQAEKTDRVLARIGEEAAASLK --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) ASGPTAAAAATAAQ 2) HYYSSVLR 3) MNKAGAG | 13 141 1 | 26 148 7 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab