<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20398
| Description |
Cyclin-C1-1 |
| Sequence | MSCFPLLENLRNIYLYLMYKMGLILASINYQVKLSYTRMAGMLLYKCPSYELMNYDIARLAQNVKVRQRVVATAVTYMRRAYTRMSMTEYDPRLVAPTCLYLASKAEESTVQARLLVFYIKKLHTDEKYRYEIKEILEMEMKILEALNYYLVVFHPYRALSQLLQDAGMSDATQMTWGLINDSYKMDLILIYPPHTIALACIYVASMLKDKDNIVWFEQLRVDMNMVEKIATEILDFYDNHKTITDEKVNAAMQKLTPRT |
| Length | 260 |
| Position | Kinase |
| Organism | Artemisia annua (Sweet wormwood) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> campanulids> Asterales> Asteraceae> Asteroideae> Anthemideae>
Artemisiinae> Artemisia.
|
| Aromaticity | 0.11 |
| Grand average of hydropathy | -0.038 |
| Instability index | 45.21 |
| Isoelectric point | 8.47 |
| Molecular weight | 30562.69 |
| Publications | PubMed=29703587
|
Function
| Annotated function |
|
| GO - Cellular Component | integral component of membrane GO:0016021 IEA:UniProtKB-KW
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
| GO - Biological Process | cell cycle GO:0007049 IEA:UniProtKB-KW
cell division GO:0051301 IEA:UniProtKB-KW
regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP20398
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.94| 16| 44| 28| 45| 2
---------------------------------------------------------------------------
28- 45 (20.81/22.57) INYqVKLSYTRMAgMLLY
75- 90 (31.13/20.37) VTY.MRRAYTRMS.MTEY
---------------------------------------------------------------------------
|