<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20380
Description |
Cyclin family protein |
Sequence | MATNFWTSTHLKELLEQEEVDVVHNLDKQRGITLDDFKLIKLQMTNYIARLAQNVKVRQRVVATAVTYMRRVYTKRSMTEYDPRLLAPSCLYLAAKSEESTVQARLLVFYIKKIYPDERYRCEIKEILEMEMKILEALNYYLVVFHPYRSLPQLLQDAGMSDAIQLTWGIVNDTYRMDLILIHPPYLIGLACIYVASVLNEKDNTAWFEDLRVDMNVVKNIAMEILDFYDKQRTISDERVNAAMHKLGLRK |
Length | 251 |
Position | Kinase |
Organism | Artemisia annua (Sweet wormwood) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> campanulids> Asterales> Asteraceae> Asteroideae> Anthemideae>
Artemisiinae> Artemisia.
|
Aromaticity | 0.10 |
Grand average of hydropathy | -0.161 |
Instability index | 43.65 |
Isoelectric point | 6.97 |
Molecular weight | 29482.04 |
Publications | PubMed=29703587
|
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
GO - Biological Process | cell cycle GO:0007049 IEA:UniProtKB-KW
cell division GO:0051301 IEA:UniProtKB-KW
regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP20380
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 41.54| 11| 35| 41| 51| 1
---------------------------------------------------------------------------
41- 51 (20.17/12.60) KLQMTNYIARL
75- 85 (21.37/13.71) KRSMTEYDPRL
---------------------------------------------------------------------------
|