<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20377
| Description |
Uncharacterized protein |
| Sequence | MHGMSTSLLSTVSDSRLKSKGSGKRRSGEDAEVKEIWETVAGGDSERFRRSGSEEEKISAATVLCGASLTRGWNIQEHTGFFIIKLLSPPVPVDYCGNESHLIVYAPLLNVLLIGISSLDCVQIFSLHGLMAEKACVKRLQKEYRALWVLAGDLASVVEVVVLVALPRQAPASLKTLSSTLSKF |
| Length | 184 |
| Position | Tail |
| Organism | Artemisia annua (Sweet wormwood) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> campanulids> Asterales> Asteraceae> Asteroideae> Anthemideae>
Artemisiinae> Artemisia.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | 0.111 |
| Instability index | 56.16 |
| Isoelectric point | 8.36 |
| Molecular weight | 19959.87 |
| Publications | PubMed=29703587
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | regulation of phenylpropanoid metabolic process GO:2000762 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP20377
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 67.42| 20| 21| 25| 45| 1
---------------------------------------------------------------------------
25- 45 (32.51/22.50) RRSGEDAEvKEIWETVAGGDS
49- 68 (34.91/19.94) RRSGSEEE.KISAATVLCGAS
---------------------------------------------------------------------------
|