<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20376
| Description |
1-deoxy-d-xylulose 5-phosphate synthase |
| Sequence | MVSLSQQPTGSDALFIPEGCQDFRFHGLIIPEHVPPKELWNLSTFYPLSHVRTHGFILSAQDIEKIQKDLYLHDWNDTHQKIVGKLQHCDSLPQQPKNEQLEKLKVFKNMQKRKISMSSQMQTGNEDGETFERSKVPAFPLKVFFFCEEEPNIGGETPIVLSHVIYDKMKQKYPEAAKLGMTLEWTDDGVETVIGPIPAIKFDETRQSKIWFNSIVANWPLILVGKMQKTTGINMVPGIGIWELIKYFAEAHIKEAEVDNKIVAIHAAMGAGLATAGLKPFYAIYSSFLQQGYDQVVHDVDLQKLPVRFAMDISGLVGADGPTLWSI |
| Length | 327 |
| Position | Tail |
| Organism | Artemisia annua (Sweet wormwood) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> campanulids> Asterales> Asteraceae> Asteroideae> Anthemideae>
Artemisiinae> Artemisia.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.206 |
| Instability index | 39.57 |
| Isoelectric point | 5.89 |
| Molecular weight | 36896.09 |
| Publications | PubMed=29703587
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | 1-deoxy-D-xylulose-5-phosphate synthase activity GO:0008661 IEA:InterPro
oxidoreductase activity GO:0016491 IEA:UniProtKB-KW
|
| GO - Biological Process | terpenoid biosynthetic process GO:0016114 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP20376
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 59.12| 18| 33| 154| 171| 1
---------------------------------------------------------------------------
154- 171 (32.22/20.47) GGETPI.VLSHVIYDKMKQ
189- 207 (26.91/16.08) GVETVIgPIPAIKFDETRQ
---------------------------------------------------------------------------
|