<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20374

Description Phytochrome and flowering time regulatory protein (PFT1)
SequenceMAADKKQLILCVEGTAALGPYWRTILSDYLDKVIRSFCDNETLKSPGTIVELALIVFNSHGCYSSCLVRRSGWTRNVDYFFEWLSAIHFSGGGFCDAAIAEGLGEALMMFPVNAAQNQHNIGVQRHCILVAASNPYPLPTPVYRPPIQKTEPTDNTEAQSESRLSDAETIAKTFPQCPVSLSVICPKQLPKLKAIYNAGKRNPSAGEPTIDVVKNPHYLVLISETFMEARAALSRSGITTLPSQSPIKVDQSSVPPVSGPPPTSVPPVNGSMMNRQPVPVGSVPPTTVKVEPTTVPSMPPAPVPVPAPSFQHVPPVARPTSQGIPTMQTSSPLSVSQDMLSNNDTVMQDMKPNVTGMQQPARPAGPVNVSILNNLSQARLMNNGTSMGIPSIGGNPMAMHMSNMISSGMASTVPVSQTVISSGQPGIAPISGTVQSTVPVPSSFTSTTSNMTGSPSQPLGNLQGSVGMGQPVSGISQGNLPGTGPQMVQSGMGMNQNMMGGVGQGQSGMTGVGTGTGTGSGPGMMPTPGIGQQVPGMQTLGVNNNTAANAGLSQQTSGGGALQSAQSKYVKVWEGNLSGQRQGQPVFITRLEGYRSASASESLAANWPPTMQIVRLISQDHMNNKYASPSITSSHFLRATCKFLLTYYIFINVFCLRNRQYVGKADFLVFRAMNQHGFLGQLQEKKLVS
Length689
PositionUnknown
OrganismArtemisia annua (Sweet wormwood)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> campanulids> Asterales> Asteraceae> Asteroideae> Anthemideae> Artemisiinae> Artemisia.
Aromaticity0.06
Grand average of hydropathy-0.156
Instability index54.38
Isoelectric point9.14
Molecular weight72800.43
Publications
PubMed=29703587

Function

Annotated function 
GO - Cellular Component
GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP20374
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             7|     394.30|      56|      56|     420|     475|       1
---------------------------------------------------------------------------
  204-  260 (54.45/17.16)	.SAGEPTIDVVK.N..P.HYLVLIS...............ETFMEaraalSRSG...ITTLPSQsPI....KVDQSSV....PPV....SGP
  272-  308 (54.04/16.97)	MMNRQP..VPVG.S..VPPTTVKVE..................PT.....TVPS...MPPAPV....................PV....PAP
  310-  360 (47.58/14.04)	FQHVPPVARPTSqGipTMQTSSPL....................S.....VSQD...MLSNNDT.VM....QDMKPNVtGMQQP........
  361-  404 (30.33/ 6.20)	.................ARPAGPVN...............VSILN.....NLSQarlMNNGTSM.GI....P....SI.G.GNPMamhmSNM
  420-  475 (97.86/36.89)	ISSGQPGIAPIS.G..TVQSTVPVP...............SSFTS.....TTSN...MTGSPSQ.PL....GNLQGSV.GMGQPV....SGI
  481-  516 (55.01/17.42)	PGTG.....P...Q..MVQSGMGMN...............Q............N...MMG...........GVGQGQS.GMTGVG....TGT
  517-  586 (55.03/17.43)	GTGSGPGMMPTP.G..IGQQ.VPGMqtlgvnnntaanaglSQQTS.....GGGA...LQSAQSK.YVkvweGNLSGQ..RQGQPV.......
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      57.70|      17|      56|      37|      57|       2
---------------------------------------------------------------------------
   37-   57 (26.03/23.03)	FCDNETLKSPGTivelALIVF
   94-  110 (31.68/18.22)	FCDAAIAEGLGE....ALMMF
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP20374 with Med25 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) ALSRSGITTLPSQSPIKVDQSSVPPVSGPPPTSVPPVNGSMMNRQPVPVGSVPPTTVKVEPTTVPSMPPAPVPVPAPSFQHVPPVARPTSQGIPTMQTSSPLSVSQDMLSNNDTVMQDMKPNVTGMQQPARPAGPVNVSILNNLSQARLMNNGTSMGIPSIGGNPMAMHMSNMISSGMASTVPVSQTVISSGQPGIAPISGTVQSTVPVPSSFTSTTSNMTGSPSQPLGNLQGSVGMGQPVSGISQGNLPGTGPQMVQSGMGMNQNMMGGVGQGQSGMTGVGTGTGTGSGPGMMPTPGIGQQVPGMQTLGVNNNTAANAGLSQQTSG
232
558










Molecular Recognition Features






MoRF SequenceStartStop




NANANA